Anti-CKAP5
Catalog Number:
ATA-HPA040375
- Images (9)
| Article Name: | Anti-CKAP5 |
| Biozol Catalog Number: | ATA-HPA040375 |
| Supplier Catalog Number: | HPA040375 |
| Alternative Catalog Number: | ATA-HPA040375-100,ATA-HPA040375-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ch-TOG, KIAA0097, TOG, TOGp |
| cytoskeleton associated protein 5 |
| Anti-CKAP5 |
| Clonality: | Polyclonal |
| Concentration: | 0.4 mg/ml |
| Isotype: | IgG |
| NCBI: | 9793 |
| UniProt: | Q14008 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | MSSKLNQARSMSGHPEAAQMVRREFQLDLDEIENDNGTVRCEMPELVQHKLDDIFEPVLIPEPKIRAVSPHFDDMHSNTASTINFI |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CKAP5 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500 |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli, plasma membrane & centrosome. |
|
|
Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neurons. |
|
|
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells. |
|
|
HPA040375-100ul |
|
|
|
|
|
HPA040375-100ul |
|
|
HPA040375-100ul |
Product Guarantee and Expert Support
