Anti-NUTM1
Catalog Number:
ATA-HPA040421
- Images (8)
| Article Name: | Anti-NUTM1 |
| Biozol Catalog Number: | ATA-HPA040421 |
| Supplier Catalog Number: | HPA040421 |
| Alternative Catalog Number: | ATA-HPA040421-100,ATA-HPA040421-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C15orf55, DKFZp434O192, FAM22H, NUT |
| NUT midline carcinoma, family member 1 |
| Anti-NUTM1 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 256646 |
| UniProt: | Q86Y26 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | TCPLNVHSYDPQGEGRVDPDLSKPKNLAPLQESQESYTTGTPKATSSHQGLGSTLPRRGTRNAIVPRETSVSKTHRSA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | NUTM1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemistry analysis in human testis and endometrium tissues using HPA040421 antibody. Corresponding NUTM1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
Immunohistochemical staining of human endometrium shows no positivity in glandular cells as expected. |
|
|
Immunohistochemical staining of human testis shows weak to moderate nuclear positivity in a subset of cells in seminiferous ducts. |
|
|
HPA040421-100ul |
|
|
HPA040421-100ul |
|
|
HPA040421-100ul |
Product Guarantee and Expert Support
