Anti-FOPNL
Catalog Number:
ATA-HPA040599
- Images (8)
| Article Name: | Anti-FOPNL |
| Biozol Catalog Number: | ATA-HPA040599 |
| Supplier Catalog Number: | HPA040599 |
| Alternative Catalog Number: | ATA-HPA040599-100,ATA-HPA040599-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C16orf63, DKFZp686N1651, FLJ31153, FOR20, PHSECRG2 |
| FGFR1OP N-terminal like |
| Anti-FOPNL |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 123811 |
| UniProt: | Q96NB1 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | IHELNAFEESKDNTIPLLYGILAHFLRGTKDGIQNAFLKGPSLQPSDPSLGRQPSRRKPMDDHLRKEEQKSTNIEDLHVSQ |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | FOPNL |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to centrosome. |
|
|
Immunohistochemical staining of human fallopian tube shows strong membranous positivity in glandular cells. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and FOPNL over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY408241). |
|
|
HPA040599-100ul |
|
|
|
|
|
|
|
|
HPA040599-100ul |
|
|
HPA040599-100ul |
Product Guarantee and Expert Support
