Anti-HAUS1
Catalog Number:
ATA-HPA040601
- Images (8)
| Article Name: | Anti-HAUS1 |
| Biozol Catalog Number: | ATA-HPA040601 |
| Supplier Catalog Number: | HPA040601 |
| Alternative Catalog Number: | ATA-HPA040601-100,ATA-HPA040601-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CCDC5, FLJ40084, HEI-C, HsT1461 |
| HAUS augmin-like complex, subunit 1 |
| Anti-HAUS1 |
| Clonality: | Polyclonal |
| Concentration: | 1.0 mg/ml |
| Isotype: | IgG |
| NCBI: | 115106 |
| UniProt: | Q96CS2 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | QEERETQVAAWLKKIFGDHPIPQYEVNPRTTEILHHLSERNRVRDRDVYLVIEDLKQKASEYESEAKYLQDLLMESVNFSPANLSSTGSRYLNALVD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | HAUS1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & centrosome. |
|
|
Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes. |
|
|
Western blot analysis using Anti-HAUS1 antibody HPA040601 (A) shows similar pattern to independent antibody HPA040652 (B). |
|
|
HPA040601-100ul |
|
|
|
|
|
|
|
|
HPA040601-100ul |
|
|
HPA040601-100ul |
Product Guarantee and Expert Support
