Anti-HMOX2
Catalog Number:
ATA-HPA040611
- Images (7)
| Article Name: | Anti-HMOX2 |
| Biozol Catalog Number: | ATA-HPA040611 |
| Supplier Catalog Number: | HPA040611 |
| Alternative Catalog Number: | ATA-HPA040611-100,ATA-HPA040611-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | HO-2 |
| heme oxygenase (decycling) 2 |
| Anti-HMOX2 |
| Clonality: | Polyclonal |
| Concentration: | 0.8 mg/ml |
| Isotype: | IgG |
| NCBI: | 3163 |
| UniProt: | P30519 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | MERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGENWEEQVQCPKAAQKYVERIHYIGQNEPEL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | HMOX2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 |
|
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
|
|
|
|
HPA040611-100ul |
|
|
HPA040611-100ul |
|
|
HPA040611-100ul |
Product Guarantee and Expert Support
