Anti-CALML5

Catalog Number: ATA-HPA040725
Article Name: Anti-CALML5
Biozol Catalog Number: ATA-HPA040725
Supplier Catalog Number: HPA040725
Alternative Catalog Number: ATA-HPA040725-100,ATA-HPA040725-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CLSP
calmodulin-like 5
Anti-CALML5
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 51806
UniProt: Q9NZT1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GELTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDGDGDGEISFQEFLTA
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CALML5
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:5000 - 1:10000
Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.
Immunohistochemistry analysis in human skin and skeletal muscle tissues using Anti-CALML5 antibody. Corresponding CALML5 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human skin shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
HPA040725-100ul
HPA040725-100ul
HPA040725-100ul