Anti-C20orf196

Product Overview

• Article Name: Anti-C20orf196
• Biozol Catalog Number: ATA-HPA040749
• Supplier Catalog Number: HPA040749
• Alternative Catalog Number: ATA-HPA040749-100,ATA-HPA040749-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: FLJ25067

Product Description

chromosome 20 open reading frame 196

Additional Information

Anti-C20orf196

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 149840
• UniProt: Q8IYI0
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: NNSWTAENFWLDPAVKGQSEKEEDDGLRKSLDRFYEMFGHPQPGSANSLSASVCKCLSQKITQLRGQES
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: C20orf196
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml

Images

Immunofluorescent staining of human cell line U-251 MG shows localization to endoplasmic reticulum & vesicles.

Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Immunohistochemical staining of human lymphoid tissues shows strong cytoplasmic positivity in non-germinal center cells.

Immunohistochemical staining of human gastrointestinal shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemical staining of human skeletal muscle shows negative cytoplasmic positivity in myocytes as expected.

Western blot analysis in control (vector only transfected HEK293T lysate) and C20orf196 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY407509).

HPA040749-100ul