Anti-PPIL3

Catalog Number: ATA-HPA040765
Article Name: Anti-PPIL3
Biozol Catalog Number: ATA-HPA040765
Supplier Catalog Number: HPA040765
Alternative Catalog Number: ATA-HPA040765-100,ATA-HPA040765-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CyPJ
peptidylprolyl isomerase (cyclophilin)-like 3
Anti-PPIL3
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 53938
UniProt: Q9H2H8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANP
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: PPIL3
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemical staining of human stomach, upper shows strong cytoplasmic and membranous positivity in glandular cells.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA040765-100ul
HPA040765-100ul
HPA040765-100ul