Anti-TMC5

Catalog Number: ATA-HPA040810
Article Name: Anti-TMC5
Biozol Catalog Number: ATA-HPA040810
Supplier Catalog Number: HPA040810
Alternative Catalog Number: ATA-HPA040810-100,ATA-HPA040810-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ13593
transmembrane channel-like 5
Anti-TMC5
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 79838
UniProt: Q6UXY8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TEGRKIMIRLLHEQIINEGKDKMFLIEKLIKLQDMEKKANPSSLVLERREVEQQGFLHLGEHDGSLDLRSRRSVQEGNPR
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: TMC5
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500
Immunohistochemical staining of human cerebral cortex, colon, duodenum and lymph node using Anti-TMC5 antibody HPA040810 (A) shows similar protein distribution across tissues to independent antibody HPA042037 (B).
Immunohistochemical staining of human cerebral cortex using Anti-TMC5 antibody HPA040810.
Immunohistochemical staining of human colon using Anti-TMC5 antibody HPA040810.
Immunohistochemical staining of human duodenum using Anti-TMC5 antibody HPA040810.
Immunohistochemical staining of human lymph node using Anti-TMC5 antibody HPA040810.
HPA040810-100ul
HPA040810-100ul
HPA040810-100ul