Anti-HDDC3

Catalog Number: ATA-HPA040895
Article Name: Anti-HDDC3
Biozol Catalog Number: ATA-HPA040895
Supplier Catalog Number: HPA040895
Alternative Catalog Number: ATA-HPA040895-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MGC45386
HD domain containing 3
Anti-HDDC3
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 374659
UniProt: Q8N4P3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PKLERKRLQVEQAPHSSPGAKLVKLADKLYNLRDLNRCTPEGWSEHRVQEYFEWAAQVVKGLQGTNRQLEEALKHLFKQR
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: HDDC3
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Immunohistochemical staining of human stomach, lower shows strong cytoplasmic and nuclear positivity in glandular cells.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
HPA040895-100ul
HPA040895-100ul
HPA040895-100ul