Anti-PSTPIP2

Catalog Number: ATA-HPA040944
Article Name: Anti-PSTPIP2
Biozol Catalog Number: ATA-HPA040944
Supplier Catalog Number: HPA040944
Alternative Catalog Number: ATA-HPA040944-100,ATA-HPA040944-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: PSTPIP2
proline-serine-threonine phosphatase interacting protein 2
Anti-PSTPIP2
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 9050
UniProt: Q9H939
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LVNPKQQEKLFVKLATSKTAVEDSDKAYMLHIGTLDKVREEWQSEHIKACEAFEAQECERINFFRNALWLHVNQLSQQC
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: PSTPIP2
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human spleen and cerebral cortex tissues using Anti-PSTPIP2 antibody. Corresponding PSTPIP2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex shows low expression as expected.
Immunohistochemical staining of human spleen shows high expression.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA040944-100ul
HPA040944-100ul
HPA040944-100ul