Anti-BBS2

Catalog Number: ATA-HPA040961
Article Name: Anti-BBS2
Biozol Catalog Number: ATA-HPA040961
Supplier Catalog Number: HPA040961
Alternative Catalog Number: ATA-HPA040961-100,ATA-HPA040961-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: BBS
Clonality: Polyclonal
Concentration: 0,05
NCBI: 583
UniProt: Q9BXC9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: FIHNPHTRNQHVSASRVFQSPLESDVSLLNINQAVSCLTAGVLNPELGYDALLVGTQTNLLAYDVYNNSDLFYREVADGANAIVLGTLGDISSPLAIIGG
Target: BBS2
HPA040961-100ul