Anti-STX12

Catalog Number: ATA-HPA041038
Article Name: Anti-STX12
Biozol Catalog Number: ATA-HPA041038
Supplier Catalog Number: HPA041038
Alternative Catalog Number: ATA-HPA041038-100,ATA-HPA041038-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: STX13, STX14
syntaxin 12
Anti-STX12
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 23673
UniProt: Q86Y82
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MSYGPLDVYRNPGPSGPQLRDFSSIIQTCSGNIQRISQATAQIKNLMSQLGTKQDSSKLQENLQQLQHSTNQLAKETNELLKE
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: STX12
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human thyroid gland shows moderate cytoplasmic positivity in glandular cells.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA041038-100ul
HPA041038-100ul
HPA041038-100ul