Anti-NPM2

Catalog Number: ATA-HPA041070
Article Name: Anti-NPM2
Biozol Catalog Number: ATA-HPA041070
Supplier Catalog Number: HPA041070
Alternative Catalog Number: ATA-HPA041070-100,ATA-HPA041070-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: NPM2
nucleophosmin/nucleoplasmin 2
Anti-NPM2
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 10361
UniProt: Q86SE8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GSGPVFLSGQERYEASDLTWEEEEEEEGEEEEEEEEDDEDEDADISLEEQSPVKQVKRLVPQKQASVAKKKKLEKEEEEIRASVRDKSPVKKAKATARAKKPGFKK
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: NPM2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli.
Immunohistochemistry analysis in human parathyroid gland and liver tissues using Anti-NPM2 antibody. Corresponding NPM2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human parathyroid gland shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
HPA041070-100ul
HPA041070-100ul
HPA041070-100ul