Anti-MPV17L
Catalog Number:
ATA-HPA041180
- Images (8)
| Article Name: | Anti-MPV17L |
| Biozol Catalog Number: | ATA-HPA041180 |
| Supplier Catalog Number: | HPA041180 |
| Alternative Catalog Number: | ATA-HPA041180-100,ATA-HPA041180-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ39599, MLPH1, MLPH2, MPV17L1 |
| MPV17 mitochondrial membrane protein-like |
| Anti-MPV17L |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 255027 |
| UniProt: | Q2QL34 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SQQSGDGTFKSAFTILYTKGTSATEGYPKK |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MPV17L |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50 |
|
|
Immunofluorescent staining of human cell line Hep G2 shows localization to vesicles. |
|
|
Immunohistochemical staining of human kidney shows cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human stomach shows cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows cytoplasmic positivity in neurons. |
|
|
HPA041180-100ul |
|
|
|
|
|
HPA041180-100ul |
|
|
HPA041180-100ul |
Product Guarantee and Expert Support
