Anti-DNAJC3

Product Overview

• Article Name: Anti-DNAJC3
• Biozol Catalog Number: ATA-HPA041326
• Supplier Catalog Number: HPA041326
• Alternative Catalog Number: ATA-HPA041326-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Molekularbiologie
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: HP58, P58, P58IPK, PRKRI

Product Description

DnaJ (Hsp40) homolog, subfamily C, member 3

Additional Information

Anti-DNAJC3

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 5611
• UniProt: Q13217
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: VEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGKLDEAEDD
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: DNAJC3
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml

Images

Immunohistochemical staining of human thyroid gland shows nuclear positivity in glandular cells.

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)

HPA041326-100ul

HPA041326-100ul