Anti-NMRAL1
Catalog Number:
ATA-HPA041353
- Images (8)
| Article Name: | Anti-NMRAL1 |
| Biozol Catalog Number: | ATA-HPA041353 |
| Supplier Catalog Number: | HPA041353 |
| Alternative Catalog Number: | ATA-HPA041353-100,ATA-HPA041353-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ25918, HSCARG, SDR48A1 |
| NmrA-like family domain containing 1 |
| Anti-NMRAL1 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 57407 |
| UniProt: | Q9HBL8 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SVARTLLEDGTFKVRVVTRNPRKKAAKELRLQGAEVVQGDQDDQVIMELALNGAYATFIVTNYWESCSQEQEVKQGKLLADLARRLGLHYVVYS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | NMRAL1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line MCF7 shows localization to nucleus. |
|
|
Immunohistochemical staining of human rectum shows strong cytoplasmic and membranous positivity in glandular cells. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and NMRAL1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY412311). |
|
|
HPA041353-100ul |
|
|
|
|
|
|
|
|
HPA041353-100ul |
|
|
HPA041353-100ul |
Product Guarantee and Expert Support
