Anti-ACD
Catalog Number:
ATA-HPA041407
| Article Name: |
Anti-ACD |
| Biozol Catalog Number: |
ATA-HPA041407 |
| Supplier Catalog Number: |
HPA041407 |
| Alternative Catalog Number: |
ATA-HPA041407-100,ATA-HPA041407-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Sonstiges |
| Application: |
WB |
| Species Reactivity: |
Human |
| Alternative Names: |
Pip1, Ptop, Tint1, Tpp1 |
| Rabbit Polyclonal ACD Antibody against Human ACD shelterin complex subunit and telomerase recruitment factor. Validated for Western Blot |
| Clonality: |
Polyclonal |
| Concentration: |
0.1 |
| NCBI: |
65057 |
| UniProt: |
Q96AP0 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Sequence: |
TLEGPCTAPPVTHWAASRCKATGEAVYTVPSSMLCISENDQLILSSLGPCQRTQGPELPPPDPALQDLSLTLIASPPSSPS |
![]()
|
WB Image Caption 1 |
