Anti-SRRM2
Catalog Number:
ATA-HPA041411
- Images (9)
| Article Name: | Anti-SRRM2 |
| Biozol Catalog Number: | ATA-HPA041411 |
| Supplier Catalog Number: | HPA041411 |
| Alternative Catalog Number: | ATA-HPA041411-100,ATA-HPA041411-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | Cwc21, KIAA0324, SRL300, SRm300 |
| serine/arginine repetitive matrix 2 |
| Anti-SRRM2 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 23524 |
| UniProt: | Q9UQ35 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RSRSSSPVTELASRSPIRQDRGEFSASPMLKSGMSPEQSRFQSDSSSYPTVDSNSLLGQSRLETAESKEKMALPPQEDATASPPRQKDKFSPFPVQDRPESSLVFK |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SRRM2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000 |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles. |
|
|
Immunohistochemical staining of human endometrium shows strong nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human small intestine shows moderate to strong nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal cells. |
|
|
Immunohistochemical staining of human skin shows strong nuclear positivity in squamous epithelial cells. |
|
|
HPA041411-100ul |
|
|
|
|
|
HPA041411-100ul |
|
|
HPA041411-100ul |
Product Guarantee and Expert Support
