Anti-DNAJC5G
Catalog Number:
ATA-HPA041445
- Images (4)
| Article Name: | Anti-DNAJC5G |
| Biozol Catalog Number: | ATA-HPA041445 |
| Supplier Catalog Number: | HPA041445 |
| Alternative Catalog Number: | ATA-HPA041445-100,ATA-HPA041445-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Molekularbiologie |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CSP-gamma, FLJ40417 |
| DnaJ (Hsp40) homolog, subfamily C, member 5 gamma |
| Anti-DNAJC5G |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 285126 |
| UniProt: | Q8N7S2 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | NAAHAILSDSKKRKIYDQHGSLGIYLYDHFGEEGVRY |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | DNAJC5G |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and DNAJC5G over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY406534). |
|
|
HPA041445-100ul |
|
|
HPA041445-100ul |
Product Guarantee and Expert Support
