Anti-ELMOD2

Catalog Number: ATA-HPA041468
Article Name: Anti-ELMOD2
Biozol Catalog Number: ATA-HPA041468
Supplier Catalog Number: HPA041468
Alternative Catalog Number: ATA-HPA041468-100,ATA-HPA041468-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MGC10084
Clonality: Polyclonal
Concentration: 0,05
NCBI: 255520
UniProt: Q8IZ81
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: YSLLKSEALKFHLYNLVPGIPTMEHFHQFYCYLVYEFDKFWFEEEPESIMYFNLYREKFHEKIKGLLLDCNVAL
Target: ELMOD2
HPA041468-100ul