Anti-POLR3E
Catalog Number:
ATA-HPA041477
- Images (9)
| Article Name: | Anti-POLR3E |
| Biozol Catalog Number: | ATA-HPA041477 |
| Supplier Catalog Number: | HPA041477 |
| Alternative Catalog Number: | ATA-HPA041477-100,ATA-HPA041477-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ChIP, ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ10509, RPC5, SIN |
| polymerase (RNA) III (DNA directed) polypeptide E (80kD) |
| Anti-POLR3E |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 55718 |
| UniProt: | Q9NVU0 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | FVMWKFTQSRWVVRKEVATVTKLCAEDVKDFLEHMAVVRINKGWEFILPYDGEFIKKHPDVVQRQHMLWTGIQAKLEKVYNLVKETMPKKPDAQ |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | POLR3E |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human stomach, lower shows strong nuclear positivity in glandular cells. |
|
|
Western blot analysis using Anti-POLR3E antibody HPA041477 (A) shows similar pattern to independent antibody HPA041419 (B). |
|
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
|
HPA041477-100ul |
|
|
|
|
|
|
|
|
HPA041477-100ul |
|
|
HPA041477-100ul |
Product Guarantee and Expert Support
