Anti-SRL
Catalog Number:
ATA-HPA041535
- Images (9)
| Article Name: | Anti-SRL |
| Biozol Catalog Number: | ATA-HPA041535 |
| Supplier Catalog Number: | HPA041535 |
| Alternative Catalog Number: | ATA-HPA041535-100,ATA-HPA041535-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | SRL |
| sarcalumenin |
| Anti-SRL |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 6345 |
| UniProt: | Q86TD4 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | ETEDANEEAPLRDRSHIEKTLMLNEDKPSDDYSAVLQRLRKIYHSSIKPLEQSYKYNELRQHEITDGEITSKPMVLFLGPWSVGKSTMINYLLGLENTRYQL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SRL |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human heart muscle and prostate tissues using Anti-SRL antibody. Corresponding SRL RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human colon, heart muscle, prostate and skeletal muscle using Anti-SRL antibody HPA041535 (A) shows similar protein distribution across tissues to independent antibody HPA045520 (B). |
|
|
Immunohistochemical staining of human prostate shows low expression as expected. |
|
|
Immunohistochemical staining of human heart muscle shows high expression. |
|
|
Immunohistochemical staining of human skeletal muscle using Anti-SRL antibody HPA041535. |
|
|
Immunohistochemical staining of human colon using Anti-SRL antibody HPA041535. |
|
|
HPA041535-100ul |
|
|
HPA041535-100ul |
|
|
HPA041535-100ul |
Product Guarantee and Expert Support
