Anti-LCMT1
Catalog Number:
ATA-HPA041559
| Article Name: |
Anti-LCMT1 |
| Biozol Catalog Number: |
ATA-HPA041559 |
| Supplier Catalog Number: |
HPA041559 |
| Alternative Catalog Number: |
ATA-HPA041559-100,ATA-HPA041559-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
ICC, IHC, WB |
| Species Reactivity: |
Human, Mouse, Rat |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: |
Unconjugated |
| Alternative Names: |
CGI-68, PPMT1 |
| leucine carboxyl methyltransferase 1 |
| Clonality: |
Polyclonal |
| Concentration: |
0.2 mg/ml |
| Isotype: |
IgG |
| NCBI: |
51451 |
| UniProt: |
Q9UIC8 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: |
RLLSNGWETASAVDMMELYNRLPRAEVSRIESLEFLDEMELLEQLMRHYCLCWATKGGNELGLKE |
| Storage: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: |
LCMT1 |
| Antibody Type: |
Monoclonal Antibody |
| Application Dilute: |
ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. |
|
Immunohistochemical staining of human testis shows nuclear and cytoplasmic positivity in cells in seminiferous ducts. |
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
HPA041559-100ul |
|
|
|
|
|
HPA041559-100ul |
|
HPA041559-100ul |