Anti-SLC5A2
Catalog Number:
ATA-HPA041603
- Images (8)
| Article Name: | Anti-SLC5A2 |
| Biozol Catalog Number: | ATA-HPA041603 |
| Supplier Catalog Number: | HPA041603 |
| Alternative Catalog Number: | ATA-HPA041603-100,ATA-HPA041603-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | SGLT2 |
| solute carrier family 5 (sodium/glucose cotransporter), member 2 |
| Anti-SLC5A2 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 6524 |
| UniProt: | P31639 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | FHEVGGYSGLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SLC5A2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human kidney and endometrium tissues using HPA041603 antibody. Corresponding SLC5A2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human lymph node shows no positivity in non-germinal center cells as expected. |
|
|
Immunohistochemical staining of human cerebral cortex shows no positivity in neurons as expected. |
|
|
Immunohistochemical staining of human kidney shows moderate positivity in apical membrane in cells in tubules. |
|
|
Immunohistochemical staining of human endometrium shows no positivity in glandular cells as expected. |
|
|
HPA041603-100ul |
|
|
HPA041603-100ul |
|
|
HPA041603-100ul |
Product Guarantee and Expert Support
