Anti-POU1F1
Catalog Number:
ATA-HPA041646
- Images (8)
| Article Name: | Anti-POU1F1 |
| Biozol Catalog Number: | ATA-HPA041646 |
| Supplier Catalog Number: | HPA041646 |
| Alternative Catalog Number: | ATA-HPA041646-100,ATA-HPA041646-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | GHF-1, PIT1, POU1F1a |
| POU class 1 homeobox 1 |
| Anti-POU1F1 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 5449 |
| UniProt: | P28069 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | CKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFGEQNKPSSQEIMRMAE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | POU1F1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemical staining of human liver, pancreas, pituitary gland and tonsil using Anti-POU1F1 antibody HPA041646 (A) shows similar protein distribution across tissues to independent antibody HPA050624 (B). |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected. |
|
|
Immunohistochemical staining of human tonsil shows no positivity in non-germinal center cells as expected. |
|
|
Immunohistochemical staining of human pituitary gland shows moderate to strong nuclear positivity in neuroendocrine cells in the anterior lobe. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
HPA041646-100ul |
|
|
HPA041646-100ul |
|
|
HPA041646-100ul |
Product Guarantee and Expert Support
