Anti-LRP3

Catalog Number: ATA-HPA041658
Article Name: Anti-LRP3
Biozol Catalog Number: ATA-HPA041658
Supplier Catalog Number: HPA041658
Alternative Catalog Number: ATA-HPA041658-100,ATA-HPA041658-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: hLRp105, LRP-3
Clonality: Polyclonal
Isotype: IgG
NCBI: 4037
UniProt: O75074
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: RLGSFYGSFASPDLFGAARGPSDLHCTWLVDTQDSRRVLLQLELRLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYH
Target: LRP3
Antibody Type: Monoclonal Antibody
HPA041658-100ul