Anti-CCDC124

Catalog Number: ATA-HPA041708
Article Name: Anti-CCDC124
Biozol Catalog Number: ATA-HPA041708
Supplier Catalog Number: HPA041708
Alternative Catalog Number: ATA-HPA041708-100,ATA-HPA041708-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CCDC124
coiled-coil domain containing 124
Anti-CCDC124
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 115098
UniProt: Q96CT7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KAKSHLEVPLEENVNRRVLEEGSVEARTIEDAIAVLSVAEEAADRHPERRMRAAFTAFEEAQLPRLKQENPNMRLSQLKQLLKKEWL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CCDC124
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.
Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Western blot analysis in control (vector only transfected HEK293T lysate) and CCDC124 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY408696).
HPA041708-100ul
HPA041708-100ul
HPA041708-100ul