Anti-SULT2B1
Catalog Number:
ATA-HPA041724
- Images (8)
| Article Name: | Anti-SULT2B1 |
| Biozol Catalog Number: | ATA-HPA041724 |
| Supplier Catalog Number: | HPA041724 |
| Alternative Catalog Number: | ATA-HPA041724-100,ATA-HPA041724-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | HSST2 |
| sulfotransferase family, cytosolic, 2B, member 1 |
| Anti-SULT2B1 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 6820 |
| UniProt: | O00204 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | HIKGWLRMKGKDNFLFITYEELQQDLQGSVERICGFLGRPLGKEALGSVVAHSTFSAMKANTMSNYTLLPPSLLDHRR |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SULT2B1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles. |
|
|
Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells. |
|
|
Western blot analysis using Anti-SULT2B1 antibody HPA041724 (A) shows similar pattern to independent antibody HPA043539 (B). |
|
|
|
|
|
HPA041724-100ul |
|
|
|
|
|
HPA041724-100ul |
|
|
HPA041724-100ul |
Product Guarantee and Expert Support
