Anti-LDHD

Catalog Number: ATA-HPA041766
Article Name: Anti-LDHD
Biozol Catalog Number: ATA-HPA041766
Supplier Catalog Number: HPA041766
Alternative Catalog Number: ATA-HPA041766-100,ATA-HPA041766-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: LDHD
lactate dehydrogenase D
Anti-LDHD
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 197257
UniProt: Q86WU2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PWRGYCSQKAKGELCRDFVEALKAVVGGSHVSTAAVVREQHGRDESVHRCEPPDAVVWPQNVEQVSRLAALCYRQGVPIIPFGTGTGLEGGVCAVQG
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: LDHD
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human kidney and testis tissues using Anti-LDHD antibody. Corresponding LDHD RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human kidney shows high expression.
Immunohistochemical staining of human testis shows low expression as expected.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
HPA041766-100ul
HPA041766-100ul
HPA041766-100ul