Anti-CRLF1, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-CRLF1, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA041793
• Supplier Catalog Number: HPA041793
• Alternative Catalog Number: ATA-HPA041793-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: CISS, CISS1, CLF, CLF-1

Product Description

cytokine receptor-like factor 1

Additional Information

Anti-CRLF1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 9244
• UniProt: O75462
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: VLTLDILDVVTTDPPPDVHVSRVGGLEDQLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAGLKPGTVY
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml

Images

Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in tubules.

Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.