Anti-CARD6

Catalog Number: ATA-HPA041933
Article Name: Anti-CARD6
Biozol Catalog Number: ATA-HPA041933
Supplier Catalog Number: HPA041933
Alternative Catalog Number: ATA-HPA041933-100,ATA-HPA041933-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CINCIN1
Clonality: Polyclonal
Concentration: 0,6
NCBI: 84674
UniProt: Q9BX69
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QEKSIEERKKVFKDVLLCLNMDRSRKVLPDFVKQFSLDRGCKWTPESPGDLAWNFLMKVQARDVTARDSILSHKVLDEDSKEDLLAGV
Target: CARD6
HPA041933-100ul