Anti-MIDN Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA042018
Article Name: Anti-MIDN Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA042018
Supplier Catalog Number: HPA042018
Alternative Catalog Number: ATA-HPA042018-100, ATA-HPA042018-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Clonality: Polyclonal
NCBI: 90007
UniProt: Q504T8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VPKERLALLHKDTRLSSGKLQEFGVGDGSKLTLVPTVEAGLMSQASRPEQSVMQALESLTETQVSDFLSGRSPLTLALRVGDHMMFVQLQLAAQHAPLQ
Target: MIDN