Anti-ASH2L
Catalog Number:
ATA-HPA042289
- Images (7)
| Article Name: | Anti-ASH2L |
| Biozol Catalog Number: | ATA-HPA042289 |
| Supplier Catalog Number: | HPA042289 |
| Alternative Catalog Number: | ATA-HPA042289-100,ATA-HPA042289-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ASH2, ASH2L1, ASH2L2, Bre2 |
| ash2 (absent, small, or homeotic)-like (Drosophila) |
| Anti-ASH2L |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 9070 |
| UniProt: | Q9UBL3 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | TTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLELDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEM |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ASH2L |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human tonsil shows nuclear positivity in non-germinal center. |
|
|
Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ASH2L antibody. Remaining relative intensity is presented. |
|
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
|
HPA042289-100ul |
|
|
HPA042289-100ul |
|
|
HPA042289-100ul |
Product Guarantee and Expert Support
