Anti-PLD1

Catalog Number: ATA-HPA042396
Article Name: Anti-PLD1
Biozol Catalog Number: ATA-HPA042396
Supplier Catalog Number: HPA042396
Alternative Catalog Number: ATA-HPA042396-100,ATA-HPA042396-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: PLD1
phospholipase D1, phosphatidylcholine-specific
Anti-PLD1
Clonality: Polyclonal
Concentration: 0.4 mg/ml
Isotype: IgG
NCBI: 5337
UniProt: Q13393
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: NEPRVNTSALQKIAADMSNIIENLDTRELHFEGEEVDYDVSPSDPKIQEVYIPFSAIYNTQGFKEPNIQTYLSGCPIKAQVLEVERFTSTTRVPSINLYTIELTHGEFKWQVKRKFKHFQEFHR
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: PLD1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000
Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane.
Immunohistochemistry analysis in human gallbladder and skeletal muscle tissues using Anti-PLD1 antibody. Corresponding PLD1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human gallbladder shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
HPA042396-100ul
HPA042396-100ul
HPA042396-100ul