Anti-KCTD15

Catalog Number: ATA-HPA042522
Article Name: Anti-KCTD15
Biozol Catalog Number: ATA-HPA042522
Supplier Catalog Number: HPA042522
Alternative Catalog Number: ATA-HPA042522-100,ATA-HPA042522-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MGC25497
Clonality: Polyclonal
Concentration: 0,1
NCBI: 79047
UniProt: Q96SI1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MPHRKERPSGSSLHTHGSTGTAEGGNMSRLSLTRSPVSPLAAQGI
Target: KCTD15
HPA042522-100ul