Anti-GBP2

Catalog Number: ATA-HPA042682
Article Name: Anti-GBP2
Biozol Catalog Number: ATA-HPA042682
Supplier Catalog Number: HPA042682
Alternative Catalog Number: ATA-HPA042682-100,ATA-HPA042682-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: GBP2
guanylate binding protein 2, interferon-inducible
Anti-GBP2
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 2634
UniProt: P32456
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ERLLKEGFENESKRLQKDIWDIQMRSKSLEPICNIL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: GBP2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line RT4 shows localization to nucleoplasm & cytosol.
Immunohistochemical staining of human urinary bladder shows distinct cytoplasmic and nuclear positivity in urothelial cells.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
HPA042682-100ul
HPA042682-100ul
HPA042682-100ul