Anti-MRI1

Catalog Number: ATA-HPA042744
Article Name: Anti-MRI1
Biozol Catalog Number: ATA-HPA042744
Supplier Catalog Number: HPA042744
Alternative Catalog Number: ATA-HPA042744-100,ATA-HPA042744-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MGC3207, MRDI, mtnA, Ypr118w
methylthioribose-1-phosphate isomerase 1
Anti-MRI1
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 84245
UniProt: Q9BV20
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: HGIPFYVAAPSSSCDLRLETGKEIIIEERPGQELTDVNGVRIAAPGIGVWNPAFDVTPHDLITGGIITELGVFAPEELRTALTTTISSRD
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: MRI1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemical staining of human thyroid gland shows moderate cytoplasmic and nuclear positivity in glandular cells.
Western blot analysis in human cell lines HEK293 and U-251MG using Anti-MRI1 antibody. Corresponding MRI1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
HPA042744-100ul
HPA042744-100ul
HPA042744-100ul