Anti-NDUFB9

Catalog Number: ATA-HPA042768
Article Name: Anti-NDUFB9
Biozol Catalog Number: ATA-HPA042768
Supplier Catalog Number: HPA042768
Alternative Catalog Number: ATA-HPA042768-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: B22, LYRM3, UQOR22
NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 9, 22kDa
Anti-NDUFB9
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 4715
UniProt: Q9Y6M9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: FWYRQHPQPYIFPDSPGGTSYERYDCYKVPEWCLDDWHPSEKAMYPDYFAKREQWKKLRRESWEREVKQLQ
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: NDUFB9
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 1: Mouse liver tissue lysate
Lane 2: Rat liver tissue lysate
HPA042768-100ul
HPA042768-100ul
HPA042768-100ul