Anti-ADAMTS13
Catalog Number:
ATA-HPA042844
| Article Name: |
Anti-ADAMTS13 |
| Biozol Catalog Number: |
ATA-HPA042844 |
| Supplier Catalog Number: |
HPA042844 |
| Alternative Catalog Number: |
ATA-HPA042844-100,ATA-HPA042844-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Sonstiges |
| Application: |
IHC |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: |
Unconjugated |
| Alternative Names: |
C9orf8, DKFZp434C2322, FLJ42993, MGC118899, MGC118900, TTP, vWF-CP, VWFCP |
| ADAM metallopeptidase with thrombospondin type 1 motif, 13 |
| Clonality: |
Polyclonal |
| Isotype: |
IgG |
| NCBI: |
11093 |
| UniProt: |
Q76LX8 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: |
AHQEDTERYVLTNLNIGAELLRDPSLGAQFRVHLVKMVILTEPEGAPNITANLTSSLLSVCGWSQTINPEDDTDPGHADLVLYITRFDLELPDGNRQV |
| Target: |
ADAMTS13 |
| Antibody Type: |
Monoclonal Antibody |
| Application Dilute: |
IHC: 1:20 - 1:50 |
![]()
|
HPA042844-100ul |
