Anti-SOSTDC1

Catalog Number: ATA-HPA042856
Article Name: Anti-SOSTDC1
Biozol Catalog Number: ATA-HPA042856
Supplier Catalog Number: HPA042856
Alternative Catalog Number: ATA-HPA042856-100,ATA-HPA042856-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DAND7, DKFZp564D206, USAG1
Clonality: Polyclonal
Isotype: IgG
NCBI: 25928
UniProt: Q6X4U4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GYGTKYWSRRSSQEWRCVNDKTRTQRIQLQCQDGSTRTYKITVVTACKCKRYTRQHNESSHNFESMSPAKPVQHHRERKRASKSSKHSMS
Target: SOSTDC1
Antibody Type: Monoclonal Antibody
HPA042856-100ul