Anti-DTX2
Catalog Number:
ATA-HPA042931
- Images (7)
| Article Name: | Anti-DTX2 |
| Biozol Catalog Number: | ATA-HPA042931 |
| Supplier Catalog Number: | HPA042931 |
| Alternative Catalog Number: | ATA-HPA042931-100,ATA-HPA042931-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | KIAA1528, RNF58 |
| deltex 2, E3 ubiquitin ligase |
| Anti-DTX2 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 113878 |
| UniProt: | Q86UW9 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | YPVTTIIAPPGHTGVACSCHQCLSGSRTGPVSGRYRHSMTNLPAYPVPQHPPHRTASVFGTHQAFAPYNKPSL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | DTX2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & nuclear membrane. |
|
|
Immunohistochemical staining of human esophagus shows cytoplasmic and nuclear positivity in squamous epithelial cells. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 |
|
|
HPA042931-100ul |
|
|
|
|
|
HPA042931-100ul |
|
|
HPA042931-100ul |
Product Guarantee and Expert Support
