Anti-SF3B3
Catalog Number:
ATA-HPA042986
- Images (7)
| Article Name: | Anti-SF3B3 |
| Biozol Catalog Number: | ATA-HPA042986 |
| Supplier Catalog Number: | HPA042986 |
| Alternative Catalog Number: | ATA-HPA042986-100,ATA-HPA042986-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | KIAA0017, RSE1, SAP130, SF3b130 |
| splicing factor 3b, subunit 3, 130kDa |
| Anti-SF3B3 |
| Clonality: | Polyclonal |
| Concentration: | 0.4 mg/ml |
| Isotype: | IgG |
| NCBI: | 23450 |
| UniProt: | Q15393 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | DTVPVAAAMCVLKTGFLFVASEFGNHYLYQIAHLGDDDEEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDELDSLSPILFC |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SF3B3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 |
|
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
|
HPA042986-100ul |
|
|
|
|
|
HPA042986-100ul |
|
|
HPA042986-100ul |
Product Guarantee and Expert Support
