Anti-CCT6A

Catalog Number: ATA-HPA042996
Article Name: Anti-CCT6A
Biozol Catalog Number: ATA-HPA042996
Supplier Catalog Number: HPA042996
Alternative Catalog Number: ATA-HPA042996-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CCT6, Cctz, HTR3, TCP20, TCPZ, TTCP20
chaperonin containing TCP1, subunit 6A (zeta 1)
Anti-CCT6A
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 908
UniProt: P40227
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GVWDNYCVKKQLLHSCTVIATNILLVDEIMRAGMSSLK
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CCT6A
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.
Western blot analysis in human cell lines A-431 and MCF-7 using Anti-CCT6A antibody. Corresponding CCT6A RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251 MG
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA042996-100ul
HPA042996-100ul
HPA042996-100ul