Anti-PLA2G4C
Catalog Number:
ATA-HPA043083
- Images (8)
| Article Name: | Anti-PLA2G4C |
| Biozol Catalog Number: | ATA-HPA043083 |
| Supplier Catalog Number: | HPA043083 |
| Alternative Catalog Number: | ATA-HPA043083-100,ATA-HPA043083-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | cPLA2-gamma |
| phospholipase A2, group IVC (cytosolic, calcium-independent) |
| Anti-PLA2G4C |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 8605 |
| UniProt: | Q9UP65 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | EAELDLWSKAPASCYILKGETGPVVMHFPLFNIDACGGDIEAWSDTYDTFKLADTYTLDVVVLLLALAKKNVRENKKKILRELMNVAGLYYPKD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PLA2G4C |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human endometrium shows strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human prostate shows strong membranous and cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neurons. |
|
|
Immunohistochemical staining of human stomach shows strong membranous and cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis in human cell line SK-MEL-30. |
|
|
HPA043083-100ul |
|
|
HPA043083-100ul |
|
|
HPA043083-100ul |
Product Guarantee and Expert Support
