Anti-TMUB2

Catalog Number: ATA-HPA043137
Article Name: Anti-TMUB2
Biozol Catalog Number: ATA-HPA043137
Supplier Catalog Number: HPA043137
Alternative Catalog Number: ATA-HPA043137-100,ATA-HPA043137-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MGC3123
transmembrane and ubiquitin-like domain containing 2
Anti-TMUB2
Clonality: Polyclonal
Isotype: IgG
NCBI: 79089
UniProt: Q71RG4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LEHLLDIQGLPKRQAGAGSSSPEAPLRSEDSTCLPPSPGLITVRLKFLNDTEELAVARPEDTVGALKSKYFPGQESQMKL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: TMUB2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to cytosol & vesicles.
Immunohistochemical staining of human colon shows strong positivity in glandular cells.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
HPA043137-100ul
HPA043137-100ul
HPA043137-100ul