Anti-RFTN2

Catalog Number: ATA-HPA043190
Article Name: Anti-RFTN2
Biozol Catalog Number: ATA-HPA043190
Supplier Catalog Number: HPA043190
Alternative Catalog Number: ATA-HPA043190-100,ATA-HPA043190-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C2orf11, FLJ30574, Raftlin-2
Clonality: Polyclonal
Isotype: IgG
NCBI: 130132
UniProt: Q52LD8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: RHIKGEDKNKATSRSIGLDTTSSQPAESRHLPEECRLSPSRECWTKEGRLAQHNSFSGFSSSDNVLRELDDGQFDQEDGVTQ
Target: RFTN2
Antibody Type: Monoclonal Antibody
HPA043190-100ul