Anti-ALMS1

Catalog Number: ATA-HPA043200
Article Name: Anti-ALMS1
Biozol Catalog Number: ATA-HPA043200
Supplier Catalog Number: HPA043200
Alternative Catalog Number: ATA-HPA043200-100,ATA-HPA043200-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA0328
Alstrom syndrome 1
Anti-ALMS1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 7840
UniProt: None
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: DFFQHHPDKHREHMCLPLPYQNMDKTKTDYTRIKSLSINVNLGNKEVMDTTKSQVRDYPKHNGQISDPQRDQKVTP
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ALMS1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry analysis in human testis and skeletal muscle tissues using Anti-ALMS1 antibody. Corresponding ALMS1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
HPA043200-100ul
HPA043200-100ul
HPA043200-100ul