Anti-SLC6A19
Catalog Number:
ATA-HPA043207
- Images (8)
| Article Name: | Anti-SLC6A19 |
| Biozol Catalog Number: | ATA-HPA043207 |
| Supplier Catalog Number: | HPA043207 |
| Alternative Catalog Number: | ATA-HPA043207-100,ATA-HPA043207-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | SLC6A19 |
| solute carrier family 6 (neutral amino acid transporter), member 19 |
| Anti-SLC6A19 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 340024 |
| UniProt: | Q695T7 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | MVRLVLPNPGLDARIPSLAELETIEQEEASSRPKWDNK |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SLC6A19 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:2500 - 1:5000 |
|
|
Immunofluorescent staining of human cell line HEL shows localization to nucleoli. |
|
|
Immunohistochemistry analysis in human small intestine and pancreas tissues using Anti-SLC6A19 antibody. Corresponding SLC6A19 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human small intestine shows high expression. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
HPA043207-100ul |
|
|
|
|
|
HPA043207-100ul |
|
|
HPA043207-100ul |
Product Guarantee and Expert Support
