Anti-PPP2CA

Catalog Number: ATA-HPA043236
Article Name: Anti-PPP2CA
Biozol Catalog Number: ATA-HPA043236
Supplier Catalog Number: HPA043236
Alternative Catalog Number: ATA-HPA043236-100,ATA-HPA043236-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: PP2Calpha
protein phosphatase 2, catalytic subunit, alpha isozyme
Anti-PPP2CA
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 5515
UniProt: P67775
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: RCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYF
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: PPP2CA
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251 MG
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA043236-100ul
HPA043236-100ul
HPA043236-100ul